Stevens model 87a bolt assembly for sale. is a Model 86C, but this is a tube magazine gun I have.
Stevens model 87a bolt assembly for sale Stevens Arms Co Springfield -- Model 87A . We have a great online selection at the lowest prices with Fast & Free shipping on many items! New Listing Stevens Model 87H Bolt Assembly 22LR Gun Part W/Extractors. You can login or create an account; My Account; Shopping Cart; This Savage / Stevens manufactured inner magazine tube assembly is for the model 87A semi-auto rimfi Manufacturer: Savage / Stevens Model: 87A. 6. Holds 14 or 15 rounds. 22 short, long, or long rifle Semi-Automatic Rifle. 22 LR Original #4-1. 99" Finish: Blued. 22 LR Springfield 87A semi auto bolt action rifle S/L/LR - Gill Gun post war 1-TN-1101 24 inch " barrel. New (Other) $22. 8 Recoil Plug. 15 Firing Pin. 50 Stevens Model 87A . Get the best deals for Stevens Model 87A Stock at eBay. 3% positive; Seller's other items Seller's other items; Contact seller; US $75. derosnopS. Add to Wish List. Stevens Springfield Savage 87A 87D 6a Breech Bolt Assembly Left Side Extractor. Steven’s Model 87A 22 LR. 22 bolt rifle Stevens 18D-18DAC repeating bolt action shotgun, 12, 16, Stevens 89 . These rifles are not collectable/valuable. Help. Guide to Vintage Gun Parts. STEVENS MODEL 416 BOLT ACTION 22 CALIBER BENCH REST TARGET RIFLE, TRIGGER COVER. The gun is not really safe to fire but it could be in a pinch. Parts Only · Savage. Stevens Springfield Model 85 87A D Hammer Complete Assembly . Stevens model 87a d breech bolt assembly w/extractors . Collectibles; Show More. Stevens Model 325b 30-30 Bolt Action Front Sight Assembly Screws Stevens 87A 22S/L/LR Parts Kit . 9 Enhance firearm durability through Gun Parts For Stevens for unmatched reliability and performance in any situation. $79. 22 SEMI-AUTO . U. Fast & Free shipping on many items! Are you in need of Stevens Model 87J Parts? We may have what you’re looking for. SOLD. powder residue it’s hammered into a very hard substance in the interface of the barrel and receiver in front of the bolt face. Get the best deals for Stevens 87A Stock at eBay. savage model 87A parts manual free PDF ebook downloads. I have one problem the inside shell extractor is broke. Sporting Goods. Search SALE; Home ; Manufacturers ; Savage / Stevens / Springfield / Fox ; Rifles The parts you need are out there. Savage/Springfield/Stevens 887 . 22 LR, New Reproduction. 56 shipping. This is an open bolt semi-auto rifle for the . If anyone knows where I could find one I could really use it. We Specialize in old or obsolete parts at fair prices. SAVAGE STEVENS SPRINGFIELD MODEL 6A,6AB,6B,76A,87A,87B,RIFLE R&L DETENT LEVER. eBooks and manuals for Business, Education,Finance, savage - stevens model 87a | gun and game - I'm in the process of Savage Model 3 3A 22 LR Bolt Assembly, Stevens Springfield Extractor Ejector Pin. 7%. $9. More Information; Manufacturer: Stevens: Caliber/Gauge: 30-30 Win. $3. Fast & Free shipping on many items! Stevens Savage 6A 87A 7A & more Trigger Assembly No Screws. STEVENS) MODEL 87A SEMI-AUTOMA for sale. www. It can be switched to a sort of bolt gun to semi-auto. Check Details. View Product Rifle Parts. The breech bolt will move Springfield Model 87A was made in the period 1938-1940. 39 shipping. Shotgun Description: Savage / Stevens Model 59A - Bolt Action 410 Ga. 22. The gun should fall out of stock. thriftologie (136) P. Get the best deals for Stevens Savage 87A Parts at eBay. 55 MANUFACTURER: Stevens Springfield Model 87 187 Locking Bolt Steel . Great deals on STEVENS Rifle Parts. gordylew (1,247) 99%. Stevens To clean this rifle you must take it out of the stock by taking the takedown screw out on bottom of stock. $65. Find Savage/Springfield/Stevens Model 887 parts, accessories and schematics with Numrich Gun Parts. $29. Stevens, Savage model 94C, 94 24P Shotgun Trigger Guard, Plastic. 3 KB Views: 194. I have the stock off the end cap screwed off - the bolt, bolt spring, firing pin removed and locking bolt removed. Q8VJ3D-EOSP-00. SKU. We have a great online selection at the lowest prices with Fast & Free shipping on many items! Shop for Savage/Springfield/Stevens Model 87A parts, accessories and schematics with Numrich Gun Parts. 22LR PARTS LOT: Adjustable Trigger +++ #A9011. $39. $59. $22. 30 shipping. Then you can remove the bolt. r. Savage Model 3 3a 22 Lr Bolt Assembly Stevens Springfield Extractor Ejector Pin. 6 Locking Bolt Assembly. 22 Long Rifle when shot in semi-auto. Where the date code should be is only the "0", nothing else. America’s leading gun parts supplier. Fast & Free shipping on many items! Great deals on STEVENS Stock Rifle Parts. stevens savage model 87a manual documents - mega - A tube for your savage Stevens model 87A RIFLE. Firing Pin For Savage Stevens Springfield 6a 87a 76a And More Nos. 24 inch barrel Tube magazine. Great deals on STEVENS Rifle Parts for Savage. 22 S-L-LR #4. $58. Search. 71. Brand New · STEVENS. 22LR Rifle Parts, Remington Rifle Parts for . $40. We have a great online selection at the lowest prices with Fast & Free shipping on many items! Springfield Stevens Savage 87A 6A D Bolt & Extractors . 22s. Quick view Compare Add to Cart. Stevens Model 120 Find Savage 87 on sale here with the largest selection of Savage 87 anywhere online. Springfield Stevens Savage 87A 76 6 Trigger Guard & Screws. Compatibility. 22 Semi or Single shot rifle. Fast & Free shipping on many items! 87A, AB, AT, B, 6, P,M, New (Other) · STEVENS. There is a plug on the back of receiver that has to come out so the bolt can come out. SALE; Home ; Manufacturers ; Savage / Stevens / Springfield / Fox ; Rifles ; 25 Slide Action Rifle 14 Breech Bolt Assembly. Barrel Length: 21"-21. 70 shipping. Free returns. Failure to do so may incur Original and Reproduction Firearm Gun Parts Winchester STEVENS RIFLE PARTS - WINCHESTER RIFLE PARTS WINCHESTER SHOTGUN PARTS REMINGTON RIFLE PARTS REMINGTON SHOTGUN PARTS STEVENS RIFLE PARTS BROWNING PARTS COLT PARTS FLOBERT PARTS ROSSI PARTS JIMENEZ BRYCO JENNINGS PARTS by CATEGORY Savage / Stevens Model 87A Semi-Auto Rimfire Rifle Parts (603) 798-3580; MON-FRI 8:00 AM - 5:00 PM EST; Welcome. 22LR Savage 6a trigger Stevens 87A Trigger assembly Springfield model 76A 87B 87C 87D. 22Stevens model 87a 22cal semi-auto parts gun Stevens model 87a cal. 3 Front Sight. Shoots 22LR semi auto, 22 Long & 22 short single shot. hampelguns (26,694) 99. #16496 Bolt Body W/Extractors. J. Save Share Reply Quote Stevens Model 320 12g Bolt Assembly w/ Firing Pin, and Extractor New Take Off. 95 Welcome to Out Back Gun Parts, Inc. The bolt handle should just pull out with a slight tug. Buy It Now Savage/Stevens Model 87A Description: Savage/Stevens Model 87A The nickname for this rifle is the fish gill as noted by the gill slits on the left side of the rifle. Stevens made Rimfire rifles under the Springfield brand and sold them at various retail outlets including Sears Roebuck and Montgomery Wards. Caliber:. Springfield Model 120a 22cal Single Shot Breech Bolt And Small Parts Lot. I resently inhairited a Stevens Model 87A from my uncle. 35 shipping. Review Subject Required. Short video taking the bolt apart on the Stevens 87 A 22 lr. 22LR Description: This is a Savage Arms Corp. Contact Us. Stevens Model 70 Visible Loader Savage / Stevens Model 59A - Bolt Action 410 Ga. Savage/Stevens Model 87A feeding problems. Outside Magazine Guns for Sale - J. This week I will recieve two of the stevens models, I am confident the five shot magazine I have from the turqua rifles will fit the Stevens. smb50gp (8,309) 99. Opens in a Great deals on Savage Rifle Parts for Stevens. 22's. Stevens Bolt-Action Parts 47. Hope this helps Regards SAVAGE / STEVENS / SPRINGFIELD 6J, 6JDL, 6M, 6N, 6P, 187J, 187M, 187N, 87J, 87M, 87N Locking Bolt, New Reproduction. Name Email Required. Home; Shop By Brand; About Us; Reference Book; Merch; Cart ; My account; Register; Login; Savage/Springfield/Stevens 6A-6AB-6B-6C-6D-76A-87A-87AB-87AT-87B-87C-87D-87K-187 Stevens Model 66c Bolt Action Rifle 22 Cal Floorplate with Takedown Screw No 2. 16 Safety. 9%. Besides this, these early Stevens semi auto . Category. S. $17. $102. Seller Tools Add Gun Listing Add Gun Parts & Accessories Add Service Seller's Description: LSB#: 171107KL05 Make: Stevens Model: Springfield Model 87A (Same as Savage Model 6) Serial Number: NSN Year of Manufacture: 1947-1960 (From Machined Charging Handle & Chicopee Falls Address) Caliber: This rifle can be fired in single shot mode with . 99" Finish: Black. 8 Breech Bolt Spring Rod. Discover the latest Vintage Replacement Savage/Springfield/Stevens . Stevens Arms, 87A, . A. It reminds me of a sewing machine. Angie's Busy Bee Shop. Brand. 22 LR Condition:USED Metal Condition:USED Wood Condition:USED Bore Condition:USED Finish:USED Book # :15497 Price: $194. Stevens 37 . FURTHERING THE LEGACY ONE PART AT A TIME® My saved parts. 22lr Semi Auto - Rare Tenite Stock - Description: As I remember, this is the first, or one of the first, tenite stocked firearms ever made and sold in the USA. $135. Order Status 7 Breech Bolt Spring Washer. Savage/Stevens Model 200 Savage 110 Bolt Handle Guide $9. The semi-auto function is funky because it's so slow. - I have a bolt assembly for sale now. Top Rated Plus. New Listing Springfield Stevens Model 121 120 A 15 15A 125 Rear Sight Elevator & Screw-M61. Skip to main content. SKU: UPC: Current Stock: Savage 5, 5A, 5B, 6A, 6AB, 6B, 6C, and 6D. 22 S-L-LR Original. $5. $45. 99. Stevens Model 94c Parts; Savage Shooters, Savage Firearms Collectors, and Savage Hunters. Guide, Complete. 9 / 14 Extractor Spring. 16496 Sight Set. Sign In; 5. 13 Locking Bolt. Savage 1917 Sear Trip Assembly Savage / Stevens / Find Savage/Springfield/Stevens Model 87D parts and more today with Numrich Gun Parts Corp. Sale. Savage Arms Stevens 87A . Rifle Parts; Vintage Hunting Gun Parts; More. Educate yourself. Completely frozen down. USA, Model 87A, 22 Short Long or Long Rifle, Long Rifle Only As Automatic. Related: stevens savage 87a partsspringfield 87a bolt springfield 87a bolt handle springfield 87a stock. 22 S-L-LR 24" Original. Stevens Model 325-B Bolt Action Rifle Parts Kit. 24 In. Remember: Parts may require fitting by a trained gunsmith. Sponsored. Stevens Springfield Model 87A Barrel . or Best Offer +$14. Higgins Stevens Springfield Model 85 87A D Bolt Trigger Assembply w/ Screws . STEVENS MODEL 416 BOLT ACTION 22 CALIBER BENCH REST TARGET RIFLE, STOCK. Gun Parts For Sale Online Services. $7. Mark II G | 22 LR with Hardwood Stock | Savage Arms I have come into possession of a Model 87A It is a boat anchor at the the moment. 12 Breech Bolt. Description Get the best deals for Stevens Model 15 Bolt at eBay. Underneath the barrel was a long magazine tube that was capable of holding 15 rounds of standard 40-grain 22LR. Stevens Model 87a 22LR plinker, also known as the gill gun. SALE; Home ; Manufacturers ; Savage / Stevens / Springfield / Fox ; Rifles ; 87 Rifle Series ; 87B; 87B. 22LR, Ruger . 00. Condition: 3 - Great deals on Stevens . Barrel Length: 24"-24. 1 bid. View Product Details. 99. Providing rifle parts since 1950. Shop for Savage/Springfield/Stevens Model 25 Slide Action parts, accessories and schematics with Numrich Gun Parts. The Patent Number is up side down 2094577. Excellent Springfield/Stevens 87A 22LR or SL, New Listing Stevens 87A - Hammer Assembly, Complete. God bless and go TRUMP Stevens Springfield Savage 87A 87D 6a Breech Bolt Assembly Left Side Extractor. 99 shipping. you will probably wish you bought a new Savage bolt . $49. Savage Stevens Model 87A 187 6 Trigger Assembly parts USED. 0 bids. faithfuljacksurplus (5,512) 100%. Great deals on STEVENS Barrel Rifle Parts. 1 Rear Sight. The plug on back of receiver should unscrew,it's under a little spring Great deals on Savage Stevens . Pre-Owned · Savage. Buy It Now +$9. 22LR Description: This is a tube feed rifle that shoots very fast and is accurate. Each EveryGunPart parts kit comes in our unique vacuum sealed packaging Read More. The rifle Great deals on STEVENS Stock Rifle Parts. Springfield J. This model has a unique design with the left side of the receiver vented and the right side having a tab to pull back the bolt. Barrel is stamped, "Cal . Generally the different model numbers and brand names mean some differences in stock, sights, trigger guards, etc. and preceded by a larger font STEVENS, and followed by a larger font MODEL 87A. 22LR Rifle Parts, Rifle Parts for . $27. $32. STEVENS Model 84C . Angie's Busy Bee Shop (11121) 99. 6% positive; Seller's other items Seller's other items; Contact seller; US $69. Sometimes called a "Gill Gun" due to the cutouts in the receiver. Selected category All. This vintage Model 87A semi-auto rifle was Stevens’ first attempt at a semi-auto rifle. STEVENS LARGE SHOTGUN BUTT PLATE. Stevens model 87a semi-auto . Buy It Now +$3. We have a great online selection at the lowest prices with Fast & Free shipping on many items! Magazine Tube Assembly - Inner - Original This Savage / Stevens manufactured inner magazine tube assembly is for the model 87A semi-auto rimfi Manufacturer: Savage / Stevens Model: Discover Stevens 22 Rifle Parts on sale right here with the biggest option of Stevens 22 Rifle Parts anywhere online. . I picked mine up at a yard sale about '93. 00 shipping. Qty - + Add to Cart . springfield 87a stock. I prefer money orders or a check. Stevens Savage 6A 87A (and more) Magazine Guide Assembly W/ Screws. 22 caliber. Include description. Stevens & SPRINGFIELD J. 3% positive Stevens model 87a d breech bolt assembly w/extractors . Rating Required. STEVENS MODEL 258A BOLT ACTION Savage Model 3 3A 22 LR Bolt Assembly, Stevens Springfield Extractor Ejector Pin. Brand New · Savage. com Most current ‘smiths haven’t got a clue. PRICE: $260. 16 Extractor, Left. Stevens Model 520 620 Butt Plate. Quick view Compare Savage 170 Springfield 174 & 67 Ejector Assembly - P/N A77-53N. Pre-Owned · Springfield Armory. Buy It Now +$6. 22 Long Rifle Smokeless Greased Only". Attachments. Stevens Arms Model 66-c . Savage/Stevens Models 6/87 & 187 Magazine Guide, Complete $ 75. Completeness: 4 - Nearly Complete: Potentially missing some small parts such as pins, springs, etc. New This listing features a Stevens Model 87A . It also builds up in the magazine guide between the lifter, spacers, pin and spring. The Stevens334 is actually the ATA Turqua, I have two rifles in turqua model, they come with a shot magazine and a five shot magazine. The store will not work correctly when cookies are disabled. 1125221028-1. 22 short long rifle only Description: Springfield Model 87A These Springfield Model 87A are very accurate and reliable . Pre-Owned · Revelation. Made by a few different companies over the years this is the perfect gun for teaching your son or daughter how to shoot. 45 shipping. Get the best deals for Stevens Model 87 Bolt at eBay. $50. More Info. Savage Stevens Model 24 Shotgun Firing Pin Part Nos 20 Or 410 Gauge. Factory Ithaca 49 Savage 89 Stevens 89 Complete Rearfront Sights Band Lk. 15 Extractor, Right. 50. Safety Screw - Original SAVAGE / STEVENS / SPRINGFIELD 6A, 6AB, 6B, 76A, 87A, 87B, 87AB, 87AT Breech Bolt & Hammer Assembly, Complete, Used Factory Original (See A & B) The store will not work correctly when cookies are disabled. SKU: 87-769 Category: Savage Model 6/87 & 187 Tag: Magazine Guide. $31. Condition: STEVENS Model 87A 22LR. $14. Functions as a semi unless you lock the bolt, then it can be used as a single shot. r. 17 Extractor, Right. jpg. If it were mine, I would just change out the sights for the ones most normally found on 87A rifles. complete front end (barrel,tubesStevens springfield 87a " gill gun". Only 1 STEVENS MODEL 87A . 25 shipping. Excellent Pretty neat design ,kinda resembles WW2 open bolt SMG Would probably make a good M14 trainer. Stay awhile and check out the 24-Hour Gun Show. 22 Short Long Rifle Barrel No Sights. Early rifles had a flat reciever plug (at the very rear) that is unscrewed to remove the bolt/hammer assembly. or Best Offer +$6. SPRINGFIELD ( J. Not real rusty looking but most likely was never cleaned and then left to sit for no telling how many decades. Stevens Model 87a 22 Lr. Tired of Looking, Call Us. 50 shipping. Buy It Now +$5. SAVAGE / STEVENS / SPRINGFIELD 87 SERIES, 6 SERIES Magazine Tube Assembly, Inner, . Stevens 87 Ranger 86 Semi Auto 22 Rifle Barrel & Feed System. 1d 18h. You can contact my direct email at mikewyo50 at gmail. Filter. Stevens Model 110 Parts 14; Stevens Model 35M Parts 31; Stevens Model 66 Parts 1; Stevens Premier Single Shot Parts 1; Stevens Break-Action Parts 17. Springfield Stevens Savage 87A 76 6 Trigger Guard & Screws $5. The rifle has a solid wood stock with blue finish metal. 4 / 55 Hammer. $11. Fast & Free shipping on many items! Skip to main content Shop by category. Stevens made the 76A prior to WW II, also the Springfield 87A. 22 s-l-lr 87a fading bbl finish Cartridge guide spring for savage model 6a 87a trigger springfield. gunpartscorp. Savage Stevens 187 87A or similar in the series bolt parts. Stevens Model 325-B 30-30 Win Rifle Parts Kit. See our huge selection of gun parts for sale today. $44. Stevens Springfield Model 87 187N Breech Bolt Assembly . Sellers with highest buyer ratings; Returns, money back; springfield 87a bolt handle. Mine is the Springfield 87A. Fast & Free shipping on many items! Vintage Savage Stevens Model 15 Or 120 Bolt Assembly ~ Complete. ebay has lots of parts for the 87A. Stevens 66 66a 22 Lr Breech Bolt L 3416. or Best Offer +$4. When purchasing a firearm online: please get in touch with your local FFL dealer and MAKE SURE they know you will have a gun shipped to them. This Model 87A is in very good condition and features; 24" blued barrel, blued receiver, straight walnut stock, height adjustable rear iron sights, and appears to have a new magazine tube. Firearm Model: 6A, 6AB, 6B, Stevens Model 87T . Enter your search keyword Revelation Model 101 Savage Stevens 73 22" . Fast & Free shipping on many items! Great deals on STEVENS Rifle Parts for Savage. More Information; Manufacturer: Stevens: Caliber/Gauge: 22 S/L/LR. Pre-Owned. Stevens 87 for sale on eBay. or Best Offer Springfield Stevens Savage 87A 6A D Bolt & Extractors . 95. 56mm NATO DPMS A-15 Parts Gun Item S-87 UKM24-10782 16 inch " barrel. Stevens 94a Firing Pin All Gauges. 7 Stock. Get a Quote for. Otherwise the Click clack gun or some call it the Gill gun. 1d 9h. Most will charge you for figuring it out. 17 Safety The auto part is really semi-auto so don't get too excited. is a Model 86C, but this is a tube magazine gun I have. Pre-Owned · STEVENS. United States. Toggle Nav Firearm Model: 87 SERIES, 6 SERIES . Trick out or upgrade your firearm with the largest gun parts selection at eBay. Buy It Now Stevens Springfield Savage 87A 87D 6a Breech Bolt Assembly Left Side Extractor. The factory made an M1 trainer. Firearm Mfgr: SAVAGE / STEVENS / SPRINGFIELD . 22 rifles shoot shorts, longs, and long rifle cartridges interchangeably - as so stated on the barrel. If you just want to put decent sights on it for a reasonable cost. The installation of any part in the model firearm for which it is designed requires careful fitting to insure proper performance. Numrich will have all parts you need. thriftologie (136) 98. 22 s, l, l. Stevens 77h 12ga Parts Lot Bolt Barrel Trigger Furniture Mag Tube More. Stevens Favorite 1915 22 Lr Rear Sight W Elevator Y960. $4. Savage/Springfield/Stevens 87A Parts & Schematic | Numrich Gun Parts Shop for Savage/Springfield/Stevens Model 87A parts, accessories and schematics with Numrich Gun Get the best deals for Stevens Model 87 Stock at eBay. Poppert's Gun Parts has been serving the Gunsmithing community for nearly 50 years. 61 shipping. Shop by category. Stevens Springfield 315 Sxs Right Side Firing Pin W Spring. com. 323. STEVENS Model 87A 22LR TRIGGER & SAFETY ASSEMBLY w/ SPRING & SCREWS Stevens Springfield 87A Bolt Action. $19. But be aware that as said previously, SAVAGE / STEVENS / SPRINGFIELD 6A, B, AB, 66B, C, 76A, 87A, B, AB, 86C, CD Magazine Tube Assembly, Inner, New Reproduction THIS PART IS OFF OF A:: Stevens Arms/Springfield Model 87A Tube Fed Rifle, 22 SLLR, Mfg'd 1945 & 1960, 24" Barrel w/Good Bore, it Had a few dings & scratches, it functioned and Shot well, It was a Good old Rifle. . CAUTION. $100. Savage model 101 serial numbers. Description ; Additional information ; Reviews (0) Springfield 87A Description: This is a tube fed Springfield/ J. Customer Name. Toggle Nav. postrockgunparts (15,890) 99%. Product #: 203430A . Firearm Model: 87A, 87AB, 87AT, 87B, 87C, 87D, 87K, 6A, 6AB, 6B, 6C, 6D, 76A Breech Bolt Spring Washer, New Factory Original Savage Model 3 3A 22 LR Bolt Assembly, Stevens Springfield Extractor Ejector Pin. Home. Stevens 85 Breech Bolt 22 S-L-LR savage I really like the Savage 6A and 7 series which also spawned the Stevens 76A, Springfield 87A and Ranger 101. 95 shipping. lr Bolt Assembly Missing Extractor Cl650. I see little advantage to keeping it with the older, original sights. This vintage Model 87A semi-auto rifle was Stevens’ Locate Stevens Sights on sale below with the biggest choice of Stevens Sights anywhere online. About Us. springfield 87a bolt. $57. Opens in a new window or tab. Savage / Stevens / Springfield. or Best Offer. Springfield Model 87a Used 22 L. 5 / 37 Breech Bolt. 11 Extractor, Left. Careless or improper fitting may affect the operation of the firearm to a point where possible injury to the user may result. Stevens Model 301 M301 410 Black Adjustable Stock Ideal For Youth And Adult. 22 Long Rifle Rifle Parts. Is there anyplace to get a breech bolt assembly? Is there any other make and or model that is the same??? If any one else knows please advise me. Then for fixing it. We have a great online selection at the lowest prices with Fast & Free shipping on many items! New Listing Stevens Model 258A Bolt Action 20 Gauge Shotgun Stock. All Stevens 87A I too have a Stevens 87A 22cal. Our parts kits are sold as-is and we do not separate individual parts for sale. Stevens Arms Company, Chicopee Falls, Mass. 22 Rifle Savage/Springfield/Stevens 980DL-987 . 22 s-l-lr All availble savage gun repair parts-bob's gun shop,stevens gun repair SAVAGE / STEVENS / SPRINGFIELD 6A, 6AB, 6B, 76A, 87A, 87AB, 87AT, 87B Locking Bolt Assembly, Used Factory Original Locking Bolt Assembly, Used Factory Original (Inc Detent Ball & Spring) Locking Bolt Assembly, Used Factory Original (Inc Detent Ball & Spring) $28. Stevens Springfield Savage 87a 87d 6a Breech Bolt Assembly Left Side Extractor. 22 short, long, and long rifle caliber semi-automatic rifle. 22 Single Shot Shop for Savage/Springfield/Stevens Model 87A parts, accessories and schematics with Numrich Gun Parts. 00 Other Model 5. 22 Short, Long or Long Rifle, but only in . SPRINGFIELD J. Order Status. l. Comments Required. Item ships when funds come in. The right STEVENS Model 87A 22LR COMPLETE BREECH BOLT & HAMMER ASSEMBLY #CL460. I paid $50 for the gun, several old tackle boxes filled w/random crap, and 6-8 rods/reels. After WWII Stevens used the 87A At the chamber, there are 8 'gills', has the two holes through the tube to lock the bolt in the forward or rearward position. About Us | Sell Your Gun Parts. Action Type: Get your Savage/Springfield/Stevens Model 87B parts, accessories and schematics with Numrich Gun Parts. 22 Rifle Parts. Stevens Savage Springfield Model 94 107 17 4 Stainless Steel Firing Pin. Four Peaks website handle the turqua rifles. 1%. 90 shipping. $6. We have a great online selection at the lowest prices with Fast & Free shipping on many items! Savage STEVENS Model 944 12ga WOOD STOCK, STOCK BOLT & BUTTPLATE #A8530. #6 · Dec 30, 2011. Each EveryGunPart parts kit comes in our unique vacuum sealed packaging Read More Great deals on STEVENS Rifle Parts for Savage. try ebay as sometimes parts come up for sale for these guns there. 10 Extractor Plunger. 22LR Rifle Parts for Stevens, STEVENS . The trigger guard shows handling marks. Savage 1909 Round Barrel Forearm Forned - 136 $49. We don’t have asite . 22 instead. 22LR Rifle Parts, Marlin . Savage Stevens Springfield Model 87 5 6 86 66C & Early 187 Inside Magazine Tube Savage Stevens Springfield Model 87 5 6 86 66C & Early 187 Inside Magazine Tube. Stevens Model 219 Parts 9; Stevens Model 7 Great deals on STEVENS Stevens Rifle Parts. PRICE: $229. $24. Products. PRICE: Other Model . Fast & Free shipping on many items! Other Model . $69. I am looking for a new stock or even a used one if possable. 22LR- 29179B. 22 Rifle Stevens Stevens 15-15A-15B-15Y . Shotgun - Smooth walnut pistol grip style stock , forend and butt plate. long full choke Locate Springfield 22 on sale below with the biggest variety of Springfield 22 anywhere online. Quick view Compare . 18 Extractor Pin, Stevens Model 86 Bolt Action Repeating Rifle Tubular Magazine, 22 caliber Tag +$8. Stevens Gun Parts for sale on eBay. 22 LR Savage Stevens 87A Semi-Auto Rifle - 24" Barrel, Good Shape 24 inch " barrel. Country/Region of Manufacture. Stevens Model 87A . 22 LR Cal Tube Fed Semi Auto Rifle w/ 24" bbl. $99. Specials. or Best Offer +$5. Item description from the seller. roush306 (18,913) 99. My Cart. 65 shipping. Stevens Model 87H Bolt Assembly 22LR Gun Part STEVENS Model 87A 22LR COMPLETE BREECH BOLT & HAMMER ASSEMBLY #A8716. Angie's Busy Bee Shop (10913) 99. Out of stock. 22 Long Rifle Barrel Rifle Parts. 6%. Springfield / Stevens Model 87a 22LR rifle - Gill Gun Description: Classic Springfield J. He unfortionaly cut the stock just behind the trigger. The Model 87A also came standard with a wooden stock complete with included sling mounts. Markings: top of the barrel forward of the rear sight, in two lines of block characters: SAVAGE ARMS CORPORATION CHICOPEE FALLS, MASS. $35. Simply enter your details below and we will send you an e-mail when “Buttplate for Stevens Springfield Model 87A Rifle” is back in stock! We will not send you any other e-mails or add you to our newsletter, you will only be e-mailed about this product! Name: E-mail Address: Confirm E-mail: See our huge selection of gun parts for sale today. 410 Stock Discover Stevens 22 Rifle Parts on sale right here with the biggest option of Stevens 22 Rifle Parts anywhere online. Barrel marks: Springfield, J. Additional site The Savage Model 6 was not a 'click-clack' action and they would not sell parts for them as early as the 50's, they would only convert them to the later 'click-clack' action for $13, this pricing is from a 1955 parts catalog, so you may find Model 6's with a later type action. 22 LR Semi-Auto Rifle - C&R OK: Guns for Sale - Rifles For Sale - Semi Auto - Item# 12450733: The serrations on the locking bolt are sharp, and the checkering on the locking knob of the bolt is sharp but shows thinning. None are 'rare'. 2 Rear Sight Step. mcefzjoejhpsjzmeucfgaihfhrpqdaliqvavssdtvttwkynuexxm